PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00013.1.g05350.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 1080aa    MW: 114944 Da    PI: 10.8643
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00013.1.g05350.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.5e-37789846360
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Zjn_sc00013.1.g05350.1.am.mk 789 QAPLPCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 846
                                   66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575128No hitNo description
PfamPF027012.8E-31791845IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-25792843IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.357792846IPR003851Zinc finger, Dof-type
PROSITE patternPS013610794830IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
MPGALRASNT ILIAVSFYPT TIHGLGSCDL ASITLWAQVF APPARAVRGL MLYLTLVTPT  60
PTPTDRLRAL RAGRWCSFLL DAMMMAVPES LSSGAAPAPI RAGLEALGLS APHCRAEEPA  120
RSLPGARTFR EIKRCVPGRS DKAAGNGEEA HKEWNGNTER FCHVVTGSTA SFQAWFRELQ  180
QQSHPWQHGT NPEVDRHHHA LILLARAPPP LPTPPCCTLI SLPSAERRSP SRSGRREKTL  240
YEPHPIDILR ASLLDERDRI EPRAGTSTPR PSAVPVLALR ESQAKKKQQQ RGHRREGGRE  300
GDGAGAFCLH PSSVRPFVRA SFPNSESASF ARPIADRCAR HSSGFQRAQT LIRSTTRAFR  360
RHGSSMQEDE GADRRENPPS RLVDRSTDRH DRSPCPGEAQ QRGRQARTRS IVARVPRSQS  420
GSRRGHPVAL AFPPVRPSLY RFAFAGRPAR AAFVEPSRGR PRTGGGALRS SAVSRGDERA  480
AWVGLGWRLG ADEAQESGGR GAPAPPPPHR ACLRGAPVAG MPHACFPRPA SQPWESVIDD  540
KHGADRPRPG KATRPDAVRP SFAGERIPNF LSAVYDMHAW PAEKAHPSTV HTTRAGAGLK  600
YAFFATSRQG PGCLVKASSP PSRVSHAALD CMIGLASGGA PAAELDCHDH TLPVPGRPNP  660
AARFAGHAGR DVTSPRRRTT FAISKKEPII LCCFTKPFKQ LSLRFPVSPS VTMIQELLGG  720
AAMDQLKSVN DGNPASLPML LHPIVAAPSP TSSSSTSSRS SAQQPLPQRS TSATSSPQGQ  780
QQGQGAAEQA PLPCPRCNSS NTKFCYYNNY NLTQPRHFCK TCRRYWTKGG ALRNVPIGGG  840
CRKPRPMPTP AAKPVMSCKG LGVGPQLGLG VGMGMGGASP VPWAPSQQTA AAQLMALLSS  900
ARGMQGHGGS NVHRLLGLDS IGHLPLHVLP GTGNATGAPA SLWPPSAPRQ VPATPANMDS  960
QLGMGPLGHN DVLSNLGLKL PPSSQSPAPN YYNDQLHAVV SNAGRAREYD ASATSLPCTT  1020
TVTSLSPAVS SISAALSGAT AGQLDLLPVS LAAPEMQYWT GPAAMPVAWP DLPTPNGAFP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.14e-30Dof family protein